General Information

  • ID:  hor002053
  • Uniprot ID:  P07490
  • Protein name:  Progonadoliberin-1
  • Gene name:  GNRH1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
  • GO BP:  GO:0000003 reproduction; GO:0007165 signal transduction; GO:0007565 female pregnancy; GO:0010468 regulation of gene expression; GO:0014070 response to organic cyclic compound; GO:0030238 male sex determination; GO:0032496 response to lipopolysaccharide; GO:0033087 negative regulation of immature T cell proliferation; GO:0033574 response to testosterone; GO:0034695 response to prostaglandin E; GO:0035864 response to potassium ion; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
  • GO CC:  NA

Sequence Information

  • Sequence:  QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
  • Length:  69
  • Propeptide:  METIPKLMAAVVLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
  • Signal peptide:  METIPKLMAAVVLLTVCLEGCSS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Gnrhr
  • Target Unid:  P30969
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07490-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002053_AF2.pdbhor002053_ESM.pdb

Physical Information

Mass: 932213 Formula: C350H544N106O109S4
Absent amino acids: Common amino acids: E
pI: 5.62 Basic residues: 13
Polar residues: 15 Hydrophobic residues: 16
Hydrophobicity: -120.29 Boman Index: -20388
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 52.32
Instability Index: 8219.42 Extinction Coefficient cystines: 12490
Absorbance 280nm: 183.68

Literature

  • PubMed ID:  NA
  • Title:  NA